PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr026954.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family CO-like
Protein Properties Length: 860aa    MW: 93604.5 Da    PI: 5.0116
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr026954.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.13.2e-071251437
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                   C+ ++++++ l+C+ ++  lC  C ++ H+       H
  Pbr026954.1 12 VPCDFCSDQPAVLYCRADSAKLCLFCDQQVHSAnllsrkH 51
                 57*****************************555565556 PP

2zf-B_box21.26.2e-075499342
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                  ++C+++ ++ ++  C +++  lC++C    H +      H+++pl
  Pbr026954.1 54 SQICDNCASEAVSVRCSTDNLVLCQECDWDAHGScsvtaaHDRTPL 99
                 689*************************999954888888888775 PP

3CCT639.3e-22439482144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  R +a+lRYkeK+ktR+++K+irYesRKa+A++R+R+KGrFvk++
  Pbr026954.1 439 RGNAMLRYKEKKKTRRYDKHIRYESRKARADTRKRIKGRFVKAT 482
                  7789*************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.3E-13956IPR000315B-box-type zinc finger
PROSITE profilePS501199.613956IPR000315B-box-type zinc finger
PfamPF006436.6E-61253IPR000315B-box-type zinc finger
CDDcd000219.78E-91256No hitNo description
PROSITE profilePS5011910.1255299IPR000315B-box-type zinc finger
CDDcd000212.43E-75699No hitNo description
SMARTSM003362.75799IPR000315B-box-type zinc finger
PROSITE profilePS5101714.813439481IPR010402CCT domain
PfamPF062039.4E-16439481IPR010402CCT domain
SuperFamilySSF520585.53E-36497674IPR032675Leucine-rich repeat domain, L domain-like
PfamPF082631.1E-10497536IPR013210Leucine-rich repeat-containing N-terminal, plant-type
Gene3DG3DSA:3.80.10.102.3E-43498675IPR032675Leucine-rich repeat domain, L domain-like
SMARTSM00369210562585IPR003591Leucine-rich repeat, typical subtype
SMARTSM0036927586610IPR003591Leucine-rich repeat, typical subtype
SMARTSM0036949634658IPR003591Leucine-rich repeat, typical subtype
SuperFamilySSF520583.64E-33688853IPR032675Leucine-rich repeat domain, L domain-like
PfamPF082636.2E-10689728IPR013210Leucine-rich repeat-containing N-terminal, plant-type
Gene3DG3DSA:3.80.10.101.4E-39690856IPR032675Leucine-rich repeat domain, L domain-like
SMARTSM0036920778802IPR003591Leucine-rich repeat, typical subtype
SMARTSM0036934826850IPR003591Leucine-rich repeat, typical subtype
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 860 aa     Download sequence    Send to blast
MVNPKSGGVE GVPCDFCSDQ PAVLYCRADS AKLCLFCDQQ VHSANLLSRK HVRSQICDNC  60
ASEAVSVRCS TDNLVLCQEC DWDAHGSCSV TAAHDRTPLE GFSGCPSALE LASLLGLDLQ  120
DKSLLARSDP QLQNWDMGLP SMDSSWNRFG MQDLMVPIQN GVVDLTGDMK RQNSGGISGK  180
QKQGIQKQLL DLLKRDLDGS GDGRGGGGSG SENLVPGTQT RNGWQEENGN GNGDVEGLAS  240
IDVRNEKGGV GGVAARAASL ETVLQQQTPF STLLKMPEEN RDGDMLWDSN PHGQNTQIWD  300
FNLGRLRDHE GSGPLEVTYG SNVSGFMIKD FSELMKEPSL TDTKMLRDIY QMNCPVGQDD  360
TKFNITSNNP AGSLGPATSE RNNVPIGQPS SGSVFGDDKG SGASNDINFM EQSFLMRGDG  420
ISMRTLGTKA DMELLAQNRG NAMLRYKEKK KTRRYDKHIR YESRKARADT RKRIKGRFVK  480
ATTEAPDVVA IASVDCNSER DALNVWKYSL VDPNNALQSW NSTLPSPCTW YHVTCNSENS  540
VIRVDLADNN LSGILVPELG ILANLEYLEV YGNNLFGTIP EEIGNLKKLV SLDLYQNNLT  600
GTIPTSLGQL SSLRFMRFYS NRLTGSIPPS LGNLTSLQIL ELNSNLLTGT VPVEVINLVQ  660
SGSYLVTDLG HNQFDISVSS VAIASVESNS EGDALSVWKS SLVDPNNVLQ SWDPTLVNPC  720
TWFHVTCNSE NSVTRVDLGD ANLSGLIVPE LGILANLQYL EVFSNNLFGS IPKEIGNLTK  780
LVSLDLYRNN LTGTIPTSLG HLRSLRFMRV FSNSLTGPIP RSLGKLKSLQ ILELNSNLLT  840
GTIPAELLYL VRFGNLNLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4m7e_C1e-644978451157BRASSINOSTEROID INSENSITIVE 1-associated rece
4m7e_D1e-644978451157BRASSINOSTEROID INSENSITIVE 1-associated rece
4mn8_B2e-6449184520182BRASSINOSTEROID INSENSITIVE 1-associated rece
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009336468.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 15-like isoform X1
TrEMBLD9ZIW60.0D9ZIW6_MALDO; COL domain class transcription factor
STRINGVIT_01s0146g00360.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47372843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.22e-49B-box type zinc finger protein with CCT domain